Pfam domain
Pfam family: Ribosomal_S3_C (PF00189.19)
Uniprot AC: P23396
RecName: 40S ribosomal protein S3
Begin-End: 105-188
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPV
NYYVDTAVRHVLLRQGVLGIKVKI
Structures of the domain P23396 105-188
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5a2q X-ray 3.9 D 106-188 None
5flx X-ray 3.9 D 106-188 None
5oa3 X-ray 4.3 D 106-188 None


© NPIDB team 2003 - 2020

text