Pfam domain
Pfam family: KH_2 (PF07650.16)
Uniprot AC: P23396
RecName: 40S ribosomal protein S3
Begin-End: 20-96
Organism: Homo sapiens
Interaction Mode:   

Sequence:
ELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGF
PEGSVELYAEKVATRGL
Structures of the domain P23396 20-96
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5a2q X-ray 3.9 D 20-93 None
5flx X-ray 3.9 D 23-93 None
5oa3 X-ray 4.3 D 20-93 None


© NPIDB team 2003 - 2019

text