Pfam domain
Pfam family: UvrD_C (PF13361.8)
Uniprot AC: P23477
RecName: ATP-dependent helicase/deoxyribonuclease subunit B
Begin-End: 287-670
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
TPELAHLEAQYEARPAIPYAEKQEALTVMQAANRRAELEGIAREIHALVREKGYRYKDVA
ILARQPEDYKDMVKEVFADYEIPYFIDGKASMLNHPLIEFIRSSLDVLKGNWRYEAVFRC
VKTELLFPLNEPKAKVREQVDQLENYCIAYGIKGDRWTKGDRFQYRRFVSLDDDFAQTDQ
EIEMENMLNDTRDWIVPPLFQLQKRMKKAKTVQEKAEALYRYLEETDVPLKLDQERQRAE
DDGRIIEAQQHQQAWDAVIQLLEEFVEMMGDDEISLDLFQQMIEAGAESLTFSLIPPALD
QVFVGNMDLSRMYGTSCTFVLGANDGVLPARPDENGVLSDDDREWLKTIGVELSSGGRER
LLDEHFLIYMAFSSPSDRLYVSYP
Structures of the domain P23477 287-670
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3u4q X-ray 2.8 B 281-670 None
3u44 X-ray 3.2 B 281-670 None
4cej X-ray 3 B 287-670 None
4ceh X-ray 3.24 B 271-670 None
4cei X-ray 2.8 B 286-670 None


© NPIDB team 2003 - 2021

text