Pfam domain
Pfam family: PDDEXK_1 (PF12705.9)
Uniprot AC: P23478
RecName: ATP-dependent helicase/nuclease subunit A
Begin-End: 1044-1229
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
YRRPAFMMKKGLTAAEKGTAMHTVMQHIPLSHVPSIEEAEQTVHRLYEKELLTEEQKDAI
DIEEIVQFFHTEIGGQLIGAKWKDREIPFSLALPAKEIYPDAHEADEPLLVQGIIDCLYE
TEDGLYLLDYKSDRIEGKFQHGFEGAAPILKKRYETQIQLYTKAVEQIAKTKVKGCALYF
FDGGHI
Structures of the domain P23478 1044-1229
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3u4q X-ray 2.8 A 1028-1229 None
3u44 X-ray 3.2 A 1028-1229 None
4cej X-ray 3 A 1013-1229 None
4ceh X-ray 3.24 A 1018-1229 None
4cei X-ray 2.8 A 1014-1229 None


© NPIDB team 2003 - 2021

text