Pfam domain
Pfam family: Endonuc-PvuII (PF09225.9)
Uniprot AC: P23657
RecName: Type-2 restriction enzyme PvuII
Begin-End: 4-157
Organism: Proteus hauseri
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 

Sequence:
PDLNKLLELWPHIQEYQDLALKHGINDIFQDNGGKLLQVLLITGLTVLPGREGNDAVDNA
GQEYELKSINIDLTKGFSTHHHMNPVIIAKYRQVPWIFAIYRGIAIEAIYRLEPKDLEFY
YDKWERKWYSDGHKDINNPKIPVKYVMEHGTKIY
Structures of the domain P23657 4-157
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2pvi X-ray 1.76 A 5-157 None
2pvi X-ray 1.76 B 5-157 None
1pvi X-ray 2.6 A 5-157  H-Bb S-Bb L-Bb L-Mj L-Mn 
1pvi X-ray 2.6 B 5-157  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
3pvi X-ray 1.59 A 5-157  H-Bb S-Bb L-Bb L-Mj 
3pvi X-ray 1.59 B 5-157  H-Bb S-Bb L-Bb L-Mj 
1f0o X-ray 2.5 B 5-157  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1f0o X-ray 2.5 A 5-157  H-Bb S-Bb L-Bb L-Mj L-Mn 
1eyu X-ray 1.78 B 5-157  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1eyu X-ray 1.78 A 5-157  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2019

text