Pfam domain
Pfam family: GATA (PF00320.26)
Uniprot AC: P23771
RecName: Trans-acting T-cell-specific transcription factor GATA-3
Begin-End: 263-297
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 

Sequence:
CVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQN
Structures of the domain P23771 263-297
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4hc9 X-ray 1.6 A 264-297  L-Bb 
4hc9 X-ray 1.6 A 264-297  S-Bb S-Mj L-Bb L-Mj 
4hca X-ray 2.8 A 264-297  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
4hc7 X-ray 2.65 B 264-297  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
4hc7 X-ray 2.65 A 264-297 None


© NPIDB team 2003 - 2019

text