Pfam domain
Pfam family: GATA (PF00320.26)
Uniprot AC: P23771
RecName: Trans-acting T-cell-specific transcription factor GATA-3
Begin-End: 317-351
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 

Sequence:
CANCQTTTTTLWRRNANGDPVCNACGLYYKLHNIN
Structures of the domain P23771 317-351
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4hc9 X-ray 1.6 A 318-350  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
4hc9 X-ray 1.6 A 318-350 None
4hca X-ray 2.8 A 318-350  H-Bb H-Mj S-Bb S-Mj L-Mj 
4hc7 X-ray 2.65 B 318-350  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
4hc7 X-ray 2.65 A 318-350  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text