Pfam domain
Pfam family: GATA (PF00320.26)
Uniprot AC: P23772
RecName: Trans-acting T-cell-specific transcription factor GATA-3
Begin-End: 317-351
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj H-Mn S-Bb S-Mj L-Bb L-Mj 

Sequence:
CANCQTTTTTLWRRNANGDPVCNACGLYYKLHNIN
Structures of the domain P23772 317-351
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3dfv X-ray 3.1 C 317-349  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
3dfv X-ray 3.1 D 317-349  H-Bb H-Mj S-Bb L-Bb L-Mj 
3dfx X-ray 2.7 B 317-349  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
3dfx X-ray 2.7 A 317-349  H-Bb H-Mj H-Mn S-Mj L-Mj 


© NPIDB team 2003 - 2019

text