Pfam domain
Pfam family: Ribosomal_S17 (PF00366.19)
Uniprot AC: P23828
RecName: 30S ribosomal protein S17
Begin-End: 12-79
Organism: Geobacillus stearothermophilus
Interaction Mode:   

Sequence:
GRVVSDKMDKTITVLVETYKKHPLYGKRVKYSKKYKAHDEHNEAKVGDIVKIMETRPLSA
TKRFRLVE
Structures of the domain P23828 12-79
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1eg0 X-ray 11.5 G 7-74 None


© NPIDB team 2003 - 2019

text