Pfam domain
Pfam family: MutS_II (PF05188.16)
Uniprot AC: P23909
RecName: DNA mismatch repair protein MutS
Begin-End: 131-256
Organism: Escherichia coli
Interaction Mode:   

Sequence:
NLLAAIWQDSKGFGYATLDISSGRFRLSEPADRETMAAELQRTNPAELLYAEDFAEMSLI
EGRRGLRRRPLWEFEIDTARQQLNLQFGTRDLVGFGVENAPRGLCAAGCLLQYAKDTQRT
TLPHIR
Structures of the domain P23909 131-256
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3k0s X-ray 2.2 B 131-256 None
3k0s X-ray 2.2 A 131-256 None
1oh6 X-ray 2.4 A 131-256 None
1oh6 X-ray 2.4 B 131-256 None
1wb9 X-ray 2.1 A 131-256 None
1wb9 X-ray 2.1 B 131-256 None
1wbd X-ray 2.4 B 131-256 None
1wbd X-ray 2.4 A 131-256 None
1ng9 X-ray 2.6 B 131-256 None
1ng9 X-ray 2.6 A 131-256 None
1oh7 X-ray 2.5 B 131-256 None
1oh7 X-ray 2.5 A 131-256 None
1oh8 X-ray 2.9 B 131-256 None
1oh8 X-ray 2.9 A 131-256 None
2wtu X-ray 3.4 B 131-256 None
2wtu X-ray 3.4 A 131-256 None
1w7a X-ray 2.27 B 131-256 None
1w7a X-ray 2.27 A 131-256 None
1wbb X-ray 2.5 B 131-256 None
1wbb X-ray 2.5 A 131-256 None
1oh5 X-ray 2.9 B 131-256 None
1oh5 X-ray 2.9 A 131-256 None
1e3m X-ray 2.2 B 131-256 None
1e3m X-ray 2.2 A 131-256 None


© NPIDB team 2003 - 2019

text