Pfam domain
Pfam family: BamHI (PF02923.17)
Uniprot AC: P23940
RecName: Type-2 restriction enzyme BamHI
Begin-End: 8-167
Organism: Bacillus amyloliquefaciens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj 

Sequence:
ITDEAKELLSKDKLIQQAYNEVKTSICSPIWPATSKTFTINNTEKNCNGVVPIKELCYTL
LEDTYNWYREKPLDILKLEKKKGGPIDVYKEFIENSELKRVGMEFETGNISSAHRSMNKL
LLGLKHGEIDLAIILMPIKQLAYYLTDRVTNFEELEPYFE
Structures of the domain P23940 8-167
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1bhm X-ray 2.2 A 8-167  H-Bb H-Mj L-Bb L-Mj 
1bhm X-ray 2.2 B 8-167  H-Bb H-Mj L-Bb L-Mj 
3bam X-ray 1.8 B 8-167  H-Bb H-Mj S-Bb L-Bb L-Mj 
3bam X-ray 1.8 A 8-167  H-Bb H-Mj L-Bb L-Mj 
1esg X-ray 1.9 A 8-167  H-Bb L-Bb 
1esg X-ray 1.9 B 8-167 None
2bam X-ray 2 B 8-167  H-Bb H-Mj L-Bb L-Mj 
2bam X-ray 2 A 8-167  H-Bb H-Mj S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2021

text