Pfam domain
Pfam family: DNA_pol_E_B (PF04042.18)
Uniprot AC: P24482
RecName: DNA polymerase epsilon subunit B
Begin-End: 400-651
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
VILGANLFLDDLKIMTALSKILQKLNDDPPTLLIWQGSFTSVPVFASMSSRNISSSTQFK
NNFDALATLLSRFDNLTENTTMIFIPGPNDLWGSMVSLGASGTLPQDPIPSAFTKKINKV
CKNVVWSSNPTRIAYLSQEIVIFRDDLSGRFKRHRLEFPFNESEDVYTENDNMMSKDTDI
VPIDELVKEPDQLPQKVQETRKLVKTILDQGHLSPFLDSLRPISWDLDHTLTLCPIPSTM
VLCDTTSAQFDL
Structures of the domain P24482 400-651
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6hv9 X-ray 4.98 B 399-651 None


© NPIDB team 2003 - 2021

text