Pfam domain
Pfam family: T-box (PF00907.21)
Uniprot AC: P24781
RecName: T-box transcription factor T
Begin-End: 42-217
Organism: Xenopus laevis
Interaction Mode:  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj 

Sequence:
VSLEERDLWTRFKELTNEMIVTKNGRRMFPVLKVSMSGLDPNAMYTVLLDFVAADNHRWK
YVNGEWVPGGKPEPQAPSCVYIHPDSPNFGAHWMKDPVSFSKVKLTNKMNGGGQIMLNSL
HKYEPRIHIVRVGGTQRMITSHSFPETQFIAVTAYQNEEITALKIKHNPFAKAFLD
Structures of the domain P24781 42-217
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1xbr X-ray 2.5 B 42-217  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj 
1xbr X-ray 2.5 A 42-217  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text