Pfam domain
Pfam family: RNA_pol_Rpb1_2 (PF00623.19)
Uniprot AC: P24928
RecName: DNA-directed RNA polymerase II subunit RPB1
Begin-End: 356-521
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPG
AKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVR
ILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMV
Structures of the domain P24928 356-521
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5iy7 X-ray 8.6 A 356-521 None
5iya X-ray 5.4 A 356-521 None
5iy8 X-ray 7.9 A 356-521 None
5iyd X-ray 3.9 A 356-521 None
5iy6 X-ray 7.2 A 356-521 None
5iyc X-ray 3.9 A 356-521 None
5iy9 X-ray 6.3 A 356-521 None
5iyb X-ray 3.9 A 356-521 None


© NPIDB team 2003 - 2019

text