Pfam domain
Pfam family: LacI (PF00356.20)
Uniprot AC: P25144
RecName: Catabolite control protein A
Begin-End: 5-50
Organism: Bacillus subtilis
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
TIYDVAREANVSMATVSRVVNGNPNVKPTTRKKVLEAIERLGYRPN
Structures of the domain P25144 5-50
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3oqo X-ray 2.97 C 5-50  H-Bb H-Mj L-Bb L-Mj 
3oqo X-ray 2.97 A 5-50  H-Bb H-Mj L-Bb 
3oqm X-ray 2.96 C 5-50  H-Bb H-Mj L-Bb L-Mj 
3oqm X-ray 2.96 A 5-50  H-Bb H-Mj L-Bb L-Mj 
3oqn X-ray 3.3 C 5-50  H-Bb H-Mj L-Bb L-Mj 
3oqn X-ray 3.3 A 5-50  H-Mj L-Bb L-Mj 
1zvv X-ray 2.98 A 4-49 None
1zvv X-ray 2.98 B 4-49 None
1zvv X-ray 2.98 G 4-49 None


© NPIDB team 2003 - 2020

text