Pfam domain
Pfam family: Ribosomal_L7Ae (PF01248.25)
Uniprot AC: P25398
RecName: 40S ribosomal protein S12
Begin-End: 16-111
Organism: Homo sapiens
Interaction Mode:   

Sequence:
TALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALCAEHQIN
LIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVV
Structures of the domain P25398 16-111
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6g51 X-ray 4.1 M 17-110 None
6g53 X-ray 4.5 M 17-110 None
5a2q X-ray 3.9 M 17-110 None
6g5h X-ray 3.6 M 17-110 None
5flx X-ray 3.9 M 17-110 None
6g18 X-ray 3.6 M 17-110 None
6g5i X-ray 3.5 M 17-110 None
5oa3 X-ray 4.3 M 17-110 None


© NPIDB team 2003 - 2020

text