Pfam domain
Pfam family: RNA_pol_Rpc4 (PF05132.16)
Uniprot AC: P25441
RecName: DNA-directed RNA polymerase III subunit RPC4
Begin-End: 301-422
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
PERFMVFQLPTRLPAFERPAVKEEKEDMETQASDPSKKKKNIKKKDTKDALSTRELAGKV
GSIRVHKSGKLSVKIGNVVMDIGKGAETTFLQDVIALSIADDASSAELLGRVDGKIVVTP
QI
Structures of the domain P25441 301-422
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6eu0 X-ray 4 N 359-422 None
5fj8 X-ray 3.9 N 318-422 None
6cnc X-ray 4.1 N 318-422 None
6f44 X-ray 4.2 N 360-422 None
6f41 X-ray 4.3 N 360-422 None
6cnf X-ray 4.5 N 318-422 None
6eu1 X-ray 3.4 N 317-422 None
6f40 X-ray 3.7 N 360-422 None
6cnb X-ray 4.1 N 318-422 None
6f42 X-ray 5.5 N 360-422 None
6cnd X-ray 4.8 N 318-422 None


© NPIDB team 2003 - 2021

text