Pfam domain
Pfam family: Ribosomal_S5_C (PF03719.14)
Uniprot AC: P25443
RecName: 40S ribosomal protein S2
Begin-End: 159-230
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
TGKCGSVTVRLIPAPRGSGIVASPAVKKLLQLAGVEDVYTQSNGKTRTLENTLKAAFVAI
GNTYGFLTPNLW
Structures of the domain P25443 159-230
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 C 159-230 None
5ll6 X-ray 3.9 R 159-230 None
6rbe X-ray 3.8 C 159-230 None
6rbd X-ray 3.47 C 159-230 None
6eml X-ray 3.6 R 159-230 None


© NPIDB team 2003 - 2020

text