Pfam domain
Pfam family: Ribosomal_S5 (PF00333.19)
Uniprot AC: P25443
RecName: 40S ribosomal protein S2
Begin-End: 76-140
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LQDEVMNIKPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLS
VIPIR
Structures of the domain P25443 76-140
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 C 76-140 None
6eml X-ray 3.6 R 48-112 None


© NPIDB team 2003 - 2019

text