Pfam domain
Pfam family: FtsJ (PF01728.18)
Uniprot AC: P25582
RecName: 27S pre-rRNA (guanosine(2922)-2'-O)-methyltransferase
Begin-End: 25-202
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
YRARSSFKIIQINEKYGHFLEKSKVVIDLCAAPGSWCQVASKLCPVNSLIIGVDIVPMKP
MPNVITFQSDITTEDCRSKLRGYMKTWKADTVLHDGAPNVGLGWVQDAFTQSQLTLQALK
LAVENLVVNGTFVTKIFRSKDYNKLIWVFQQLFEKVEATKPPASRNVSAEIFVVCKGF
Structures of the domain P25582 25-202
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em5 X-ray 4.3 w 25-202 None


© NPIDB team 2003 - 2019

text