Pfam domain
Pfam family: DUF3381 (PF11861.7)
Uniprot AC: P25582
RecName: 27S pre-rRNA (guanosine(2922)-2'-O)-methyltransferase
Begin-End: 254-329
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
YHETSILDFVRTEDPISMLGEMNKFTIDENDHEWKILKKLKQTTDEFRSCIEDLKVLGKK
DFKMILRWRKIAREIL
Structures of the domain P25582 254-329
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em5 X-ray 4.3 w 254-744 None


© NPIDB team 2003 - 2019

text