Pfam domain
Pfam family: tRNA_Me_trans (PF03054.15)
Uniprot AC: P25745
RecName: tRNA-specific 2-thiouridylase MnmA
Begin-End: 6-360
Organism: Escherichia coli
Interaction Mode:   

Sequence:
KKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDDGEEYCTAAADLADAQAVCDKL
GIELHTVNFAAEYWDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIA
TGHYVRRADVDGKSRLLRGLDSNKDQSYFLYTLSHEQIAQSLFPVGELEKPQVRKIAEDL
GLVTAKKKDSTGICFIGERKFREFLGRYLPAQPGKIITVDGDEIGEHQGLMYHTLGQRKG
LGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLHWVDREPFTGTMR
CTVKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYNGEVCLGGGII
Structures of the domain P25745 6-360
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2der X-ray 3.1 B 6-360 None
2der X-ray 3.1 A 6-360 None
2det X-ray 3.4 A 6-360 None
2deu X-ray 3.4 B 6-360 None
2deu X-ray 3.4 A 6-360 None


© NPIDB team 2003 - 2019

text