Pfam domain
Pfam family: RHD_dimer (PF16179.4)
Uniprot AC: P25799
RecName: Nuclear factor NF-kappa-B p105 subunit
Begin-End: 249-350
Organism: Mus musculus
Interaction Mode:  L-Bb 

Sequence:
KIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFA
IVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPE
Structures of the domain P25799 249-350
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ooa X-ray 2.45 A 249-350 None
1ooa X-ray 2.45 B 249-350 None
1lei X-ray 2.7 B 249-350 None
1le5 X-ray 2.75 B 249-350  L-Bb 
1le5 X-ray 2.75 F 249-350  L-Bb 
2v2t X-ray 3.05 B 249-350  L-Bb 
1vkx X-ray 2.9 B 549-650  L-Bb 
1nfk X-ray 2.3 A 249-350  L-Bb 
1nfk X-ray 2.3 B 249-350  L-Bb 
2i9t X-ray 2.8 B 549-650  L-Bb 
1le9 X-ray 3 F 249-350 None
1le9 X-ray 3 B 249-350 None


© NPIDB team 2003 - 2019

text