Pfam domain
Pfam family: RHD_DNA_bind (PF00554.21)
Uniprot AC: P25799
RecName: Nuclear factor NF-kappa-B p105 subunit
Begin-End: 42-240
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 

Sequence:
LQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNG
KNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIR
GYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDS
TGSFTRRLEPVVSDAIYDS
Structures of the domain P25799 42-240
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ooa X-ray 2.45 A 42-240 None
1ooa X-ray 2.45 B 42-240 None
1lei X-ray 2.7 B 42-240 None
1le5 X-ray 2.75 B 42-240  S-Bb S-Mj L-Bb L-Mj 
1le5 X-ray 2.75 F 42-240  H-Bb H-Mj S-Bb S-Mj L-Bb L-Mj 
2v2t X-ray 3.05 B 42-240  H-Bb H-Mj L-Bb L-Mj 
1vkx X-ray 2.9 B 342-540  H-Bb S-Bb S-Mj L-Bb L-Mj 
1nfk X-ray 2.3 B 42-240  S-Bb S-Mj L-Bb L-Mj 
1nfk X-ray 2.3 A 42-240  S-Mj L-Bb L-Mj 
2i9t X-ray 2.8 B 342-540  H-Bb H-Mj S-Mj L-Bb L-Mj 
1le9 X-ray 3 F 42-240 None
1le9 X-ray 3 B 42-240 None


© NPIDB team 2003 - 2019

text