Pfam domain
Pfam family: zf-CXXC (PF02008.22)
Uniprot AC: P26358
RecName: DNA (cytosine-5)-methyltransferase 1
Begin-End: 647-691
Organism: Homo sapiens
Interaction Mode:   

Sequence:
AFKRRRCGVCEVCQQPECGKCKACKDMVKFGGSGRSKQACQERRC
Structures of the domain P26358 647-691
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3pta X-ray 3.6 A 647-691  L-Bb L-Mj 


© NPIDB team 2003 - 2021

text