Pfam domain
Pfam family: PAX (PF00292.20)
Uniprot AC: P26367
RecName: Paired box protein Pax-6
Begin-End: 4-128
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 

Sequence:
SHSGVNQLGGVFVNGRPLPDSTRQKIVELAHSGARPCDISRILQVSNGCVSKILGRYYET
GSIRPRAIGGSKPRVATPEVVSKIAQYKRECPSIFAWEIRDRLLSEGVCTNDNIPSVSSI
NRVLR
Structures of the domain P26367 4-128
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6pax X-ray 2.5 A 1-125  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text