Pfam domain
Pfam family: RRM_1 (PF00076.21)
Uniprot AC: P26368
RecName: Splicing factor U2AF 65 kDa subunit
Begin-End: 261-331
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGL
NGMQLGDKKLL
Structures of the domain P26368 261-331
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3vaj X-ray 1.9 B 261-330 None
3vaj X-ray 1.9 A 261-330 None
3vah X-ray 2.5 B 261-330 None
3vah X-ray 2.5 A 261-330 None
3vai X-ray 2.2 B 261-330 None
3vai X-ray 2.2 A 261-330 None
4tu8 X-ray 1.92 A 261-330 None
4tu8 X-ray 1.92 B 261-330 None
2yh1 NMR A 261-330 None
4tu9 X-ray 1.99 B 261-330 None
4tu9 X-ray 1.99 A 261-330 None
5ev4 X-ray 1.57 A 261-330 None
5ev1 X-ray 2.04 A 261-330 None
3vag X-ray 2.19 B 261-330 None
3vag X-ray 2.19 A 261-330 None
5ev2 X-ray 1.86 A 261-330 None
3vam X-ray 2.4 A 261-330 None
3vam X-ray 2.4 B 261-330 None
5ev3 X-ray 1.5 A 261-330 None
3val X-ray 2.5 I 261-330 None
3val X-ray 2.5 D 261-330 None
3val X-ray 2.5 B 261-330 None
3val X-ray 2.5 A 261-330 None
2g4b X-ray 2.5 A 261-330 None


© NPIDB team 2003 - 2019

text