Pfam domain
Pfam family: RRM_1 (PF00076.21)
Uniprot AC: P26378
RecName: ELAV-like protein 4
Begin-End: 134-202
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGL
NGQKPSGAT
Structures of the domain P26378 134-202
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1g2e X-ray 2.3 A 127-193 None
1fxl X-ray 1.8 A 127-193 None


© NPIDB team 2003 - 2019

text