Pfam domain
Pfam family: tRNA_anti-codon (PF01336.27)
Uniprot AC: P26754
RecName: Replication factor A protein 2
Begin-End: 69-157
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
VCFVGVVRNITDHTANIFLTIEDGTGQIEVRKWSEDANDLAAGNDDSSGKGYGSQVAQQF
EIGGYVKVFGALKEFGGKKNIQYAVIKPI
Structures of the domain P26754 69-157
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6i52 X-ray 4.7 B 69-157 None


© NPIDB team 2003 - 2021

text