Pfam domain
Pfam family: Ribosomal_S7 (PF00177.20)
Uniprot AC: P26783
RecName: 40S ribosomal protein S5
Begin-End: 76-225
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
RYANKRFRKAQCPIIERLTNSLMMNGRNNGKKLKAVRIIKHTLDIINVLTDQNPIQVVVD
AITNTGPREDTTRVGGGGAARRQAVDVSPLRRVNQAIALLTIGAREAAFRNIKTIAETLA
EELINAAKGSSTSYAIKKKDELERVAKSNR
Structures of the domain P26783 76-225
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 F 83-225 None
2noq X-ray 7.3 F 83-224 None
6eml X-ray 3.6 B 83-225 None
5tzs X-ray 5.1 6 83-225 None


© NPIDB team 2003 - 2019

text