Pfam domain
Pfam family: Ribosomal_S7e (PF01251.17)
Uniprot AC: P26786
RecName: 40S ribosomal protein S7-A
Begin-End: 5-187
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
QAKILSQAPTELELQVAQAFVELENSSPELKAELRPLQFKSIREIDVAGGKKALAIFVPV
PSLAGFHKVQTKLTRELEKKFQDRHVIFLAERRILPKPSRTSRQVQKRPRSRTLTAVHDK
ILEDLVFPTEIVGKRVRYLVGGNKIQKVLLDSKDVQQIDYKLESFQAVYNKLTGKQIVFE
IPS
Structures of the domain P26786 5-187
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 H 9-186 None
6eml X-ray 3.6 U 9-186 None
5tzs X-ray 5.1 7 9-186 None


© NPIDB team 2003 - 2019

text