Pfam domain
Pfam family: Ribosomal_S11 (PF00411.18)
Uniprot AC: P27069
RecName: 40S ribosomal protein S14
Begin-End: 15-133
Organism: Kluyveromyces lactis
Interaction Mode:   

Sequence:
GVARIFASFNDTFVHVTDLSGRETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEV
GITAVHIKIRATGGTRSKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRR
Structures of the domain P27069 15-133
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5it9 X-ray 3.8 O 15-133 None
3j80 X-ray 3.75 O 15-133 None
3jam X-ray 3.46 O 15-133 None
3jaq X-ray 6 O 757-133 None
3j81 X-ray 4 O 15-133 None
3jap X-ray 4.9 O 15-133 None


© NPIDB team 2003 - 2019

text