Pfam domain
Pfam family: Ets (PF00178.21)
Uniprot AC: P27577
RecName: Protein C-ets-1
Begin-End: 336-415
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
QLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRY
YYDKNIIHKTAGKRYVYRFV
Structures of the domain P27577 336-415
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1k78 X-ray 2.25 B 336-415  H-Bb H-Mj L-Bb 
1k78 X-ray 2.25 F 336-415  H-Bb H-Mj S-Bb L-Bb 
1mdm X-ray 2.8 B 336-415  H-Bb H-Mj S-Bb L-Bb 
1k7a X-ray 2.8 A 336-415  H-Bb H-Mj S-Bb L-Bb 
1k7a X-ray 2.8 D 336-415  H-Bb H-Mj L-Bb 
1k79 X-ray 2.4 A 336-415  H-Bb H-Mj S-Bb L-Bb 
1k79 X-ray 2.4 D 336-415  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2019

text