Pfam domain
Pfam family: ribosomal_L24 (PF17136.3)
Uniprot AC: P27683
RecName: 50S ribosomal protein L24, chloroplastic
Begin-End: 105-169
Organism: Spinacia oleracea
Interaction Mode:   

Sequence:
LNLKTKHVKSKEEGEQGQIIKIEAAIHSSNVMLYSKEQEVASRVGHKILEDGRKVRYLIK
TGEIV
Structures of the domain P27683 105-169
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x8t X-ray 3.3 V 104-167 None
5h1s X-ray 3.5 W 104-167 None
5mlc X-ray 3.9 W 104-167 None
5mmi X-ray 3.25 V 105-168 None


© NPIDB team 2003 - 2019

text