Pfam domain
Pfam family: tRNA_anti-codon (PF01336.27)
Uniprot AC: P27694
RecName: Replication protein A 70 kDa DNA-binding subunit
Begin-End: 197-286
Organism: Homo sapiens
Interaction Mode:   

Sequence:
WTICARVTNKSQIRTWSNSRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYY
FSKGTLKIANKQFTAVKNDYEMTFNNETSV
Structures of the domain P27694 197-286
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1jmc X-ray 2.4 A 197-286 None


© NPIDB team 2003 - 2021

text