Pfam domain
Pfam family: Exo_endo_phos (PF03372.25)
Uniprot AC: P27695
RecName: DNA-(apurinic or apyrimidinic site) lyase
Begin-End: 65-309
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 

Sequence:
CSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSD
KEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEY
RQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELL
QAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKA
LGSDH
Structures of the domain P27695 65-309
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5wn0 X-ray 2.6 A 65-309  H-Bb S-Bb L-Bb L-Mj L-Mn 
5wn0 X-ray 2.6 B 65-309 None
5dg0 X-ray 1.8 B 65-309 None
5dg0 X-ray 1.8 A 65-309  H-Bb L-Bb L-Mn 
1de8 X-ray 2.95 A 65-309  H-Bb H-Mj L-Bb L-Mj L-Mn 
1de8 X-ray 2.95 B 65-309  H-Bb L-Bb L-Mj L-Mn 
1de9 X-ray 3 A 65-309 None
1de9 X-ray 3 B 65-309 None
5dfh X-ray 1.95 A 65-309  H-Bb H-Mj L-Bb L-Mj L-Mn 
5dfh X-ray 1.95 B 65-309 None
1dew X-ray 2.65 B 65-309  H-Bb S-Bb L-Bb L-Mj L-Mn 
1dew X-ray 2.65 A 65-309  H-Bb L-Bb L-Mj L-Mn 
6bov X-ray 1.98 A 65-309  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
6bov X-ray 1.98 B 65-309 None
5wn3 X-ray 2 B 65-309  H-Bb H-Mj L-Bb L-Mj L-Mn 
5wn3 X-ray 2 A 65-309 None
6w0q X-ray 1.89 A 65-309  H-Bb H-Mj L-Bb L-Mj L-Mn 
6w0q X-ray 1.89 B 65-309 None
6p93 X-ray 2.1 B 65-309 None
6p93 X-ray 2.1 A 65-309  H-Bb H-Mj L-Bb L-Mj L-Mn 
6p94 X-ray 2.09 B 65-309 None
6p94 X-ray 2.09 A 65-309  H-Bb H-Mj L-Bb L-Mj L-Mn 
6w3u X-ray 2.4 B 65-309  H-Bb L-Bb L-Mj L-Mn 
6w3u X-ray 2.4 A 65-309 None
5dfi X-ray 1.63 B 65-309 None
5dfi X-ray 1.63 A 65-309  H-Bb L-Bb L-Mj L-Mn 
6bot X-ray 2.3 B 65-309 None
6bot X-ray 2.3 A 65-309  H-Bb L-Bb L-Mj L-Mn 
5dfj X-ray 1.85 B 65-309 None
5dfj X-ray 1.85 A 65-309  H-Bb H-Mj L-Bb L-Mj L-Mn 
5wn5 X-ray 2.2 B 65-309  H-Bb L-Bb L-Mj L-Mn 
5wn5 X-ray 2.2 A 65-309 None
5wn2 X-ray 2.29 A 65-309  H-Bb L-Bb L-Mj L-Mn 
5wn2 X-ray 2.29 B 65-309 None
5wn4 X-ray 2.1 B 65-309  H-Bb L-Bb L-Mj L-Mn 
5wn4 X-ray 2.1 A 65-309 None
4iem X-ray 2.39 D 65-309 None
4iem X-ray 2.39 C 65-309 None
4iem X-ray 2.39 B 65-309 None
4iem X-ray 2.39 A 65-309 None
5wn1 X-ray 2.3 B 65-309 None
5wn1 X-ray 2.3 A 65-309  H-Bb S-Bb L-Bb L-Mj L-Mn 
6w3n X-ray 2.69 B 65-309  H-Bb L-Bb L-Mj L-Mn 
6w3n X-ray 2.69 A 65-309 None
6w3l X-ray 2.59 A 65-309 None
6w3l X-ray 2.59 B 65-309  H-Bb L-Bb L-Mj L-Mn 
6bou X-ray 2.54 A 65-309  H-Bb H-Mj L-Bb L-Mj L-Mn 
6bou X-ray 2.54 B 65-309 None
6bor X-ray 1.84 A 65-309  H-Bb L-Bb L-Mj L-Mn 
6bor X-ray 1.84 B 65-309 None
6boq X-ray 1.96 A 65-309  H-Bb L-Bb L-Mj L-Mn 
6boq X-ray 1.96 B 65-309 None
5dff X-ray 1.57 A 65-309  H-Bb H-Mj L-Bb L-Mj L-Mn 
5dff X-ray 1.57 B 65-309 None
6w3q X-ray 2.49 B 65-309  H-Bb L-Bb L-Mj L-Mn 
6w3q X-ray 2.49 A 65-309 None
6bos X-ray 2.3 A 65-309  H-Bb H-Mj L-Bb L-Mj L-Mn 
6bos X-ray 2.3 B 65-309 None
6w2p X-ray 1.94 A 65-309  H-Bb L-Bb L-Mj L-Mn 
6w2p X-ray 1.94 B 65-309 None
6bow X-ray 1.59 A 65-309  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
6bow X-ray 1.59 B 65-309 None
6w43 X-ray 1.99 A 65-309  H-Bb H-Mj L-Bb L-Mj L-Mn 
6w43 X-ray 1.99 B 65-309 None
6w4t X-ray 2.77 A 65-309  H-Bb L-Bb L-Mj L-Mn 
6w4t X-ray 2.77 B 65-309  H-Bb S-Bb L-Bb L-Mj L-Mn 
6w4i X-ray 2.2 A 65-309  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
6w4i X-ray 2.2 B 65-309  H-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text