Pfam domain
Pfam family: Exo_endo_phos (PF03372.22)
Uniprot AC: P27695
RecName: DNA-(apurinic or apyrimidinic site) lyase
Begin-End: 65-309
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb L-Bb L-Mj L-Mn 

Sequence:
CSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSD
KEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEY
RQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELL
QAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKA
LGSDH
Structures of the domain P27695 65-309
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1de8 X-ray 2.95 A 66-309 None
1de8 X-ray 2.95 B 66-309 None
1de9 X-ray 3 A 66-309 None
1de9 X-ray 3 B 66-309 None
1dew X-ray 2.65 A 66-309 None
1dew X-ray 2.65 B 66-309 None
5wn5 X-ray 2.2 B 66-309  H-Bb S-Bb 
5wn5 X-ray 2.2 A 66-309 None
5dfh X-ray 1.95 A 66-309  H-Bb S-Bb L-Bb 
5dfh X-ray 1.95 B 66-309 None
5wn1 X-ray 2.3 A 66-309  H-Bb S-Bb L-Bb L-Mn 
5wn1 X-ray 2.3 B 66-309 None
5dg0 X-ray 1.8 A 66-309  H-Bb S-Bb L-Bb L-Mn 
5dg0 X-ray 1.8 B 66-309 None
5dfj X-ray 1.85 A 66-309  H-Bb S-Bb L-Bb L-Mn 
5dfj X-ray 1.85 B 66-309 None
5wn4 X-ray 2.1 B 66-309 None
5wn4 X-ray 2.1 A 66-309 None
4iem X-ray 2.39 A 66-309 None
4iem X-ray 2.39 B 66-309 None
4iem X-ray 2.39 C 66-309 None
4iem X-ray 2.39 D 66-309 None
5dfi X-ray 1.63 A 66-309  H-Bb S-Bb L-Bb L-Mn 
5dfi X-ray 1.63 B 66-309 None
5wn2 X-ray 2.29 A 66-309  S-Bb L-Mn 
5wn2 X-ray 2.29 B 66-309 None
5dff X-ray 1.57 A 66-309  H-Bb S-Bb L-Bb L-Mj L-Mn 
5dff X-ray 1.57 B 66-309 None
5wn0 X-ray 2.6 A 66-309  H-Bb L-Bb L-Mj L-Mn 
5wn0 X-ray 2.6 B 66-309 None


© NPIDB team 2003 - 2019

text