Pfam domain
Pfam family: TBP (PF00352.20)
Uniprot AC: P28147
RecName: TATA-box-binding protein 1
Begin-End: 112-195
Organism: Arabidopsis thaliana
Interaction Mode:  S-Bb S-Mn L-Bb L-Mj L-Mn 

Sequence:
DFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIV
ITGAKMRDETYKAFENIYPVLSEF
Structures of the domain P28147 112-195
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1vtl X-ray 2.25 E 112-195  S-Bb S-Mn L-Bb L-Mj L-Mn 
1vtl X-ray 2.25 F 112-195  S-Bb S-Mn L-Bb L-Mj L-Mn 
1qn5 X-ray 1.93 B 112-195 None
1qn5 X-ray 1.93 A 112-195 None
1qn6 X-ray 2.1 B 112-195 None
1qn6 X-ray 2.1 A 112-195 None
1qna X-ray 1.8 B 112-195 None
1qna X-ray 1.8 A 112-195 None
1qn4 X-ray 1.86 B 112-195  S-Bb S-Mn L-Bb L-Mj L-Mn 
1qn4 X-ray 1.86 A 112-195  S-Bb S-Mn L-Bb L-Mj L-Mn 
1qn7 X-ray 2.3 B 112-195 None
1qn7 X-ray 2.3 A 112-195 None
1qnc X-ray 2.3 A 112-195 None
1qnc X-ray 2.3 B 112-195 None
1qn9 X-ray 1.9 A 112-195 None
1qn9 X-ray 1.9 B 112-195 None
1qnb X-ray 2.23 A 112-195 None
1qnb X-ray 2.23 B 112-195 None
1vol X-ray 2.7 B 112-195  S-Bb S-Mn L-Bb L-Mj L-Mn 
1qne X-ray 1.9 A 112-195  S-Bb S-Mn L-Bb L-Mj L-Mn 
1qne X-ray 1.9 B 112-195  S-Bb S-Mn L-Bb L-Mj L-Mn 
1vto X-ray 1.9 A 112-195  S-Bb S-Mn L-Bb L-Mj L-Mn 
1vto X-ray 1.9 B 1112-1195  S-Bb S-Mn L-Bb L-Mj L-Mn 
1qn3 X-ray 1.95 B 112-195 None
1qn3 X-ray 1.95 A 112-195 None
1qn8 X-ray 2.1 A 112-195 None
1qn8 X-ray 2.1 B 112-195 None


© NPIDB team 2003 - 2019

text