Pfam domain
Pfam family: TBP (PF00352.23)
Uniprot AC: P28147
RecName: TATA-box-binding protein 1
Begin-End: 22-104
Organism: Arabidopsis thaliana
Interaction Mode:  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 

Sequence:
VPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVC
TGAKSEDFSKMAARKYARIVQKL
Structures of the domain P28147 22-104
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6uep X-ray 2.05 B 22-104  S-Bb S-Mn L-Bb L-Mn 
6uep X-ray 2.05 A 22-104  S-Bb S-Mn L-Bb L-Mn 
6njq X-ray 2.75 B 22-104  S-Bb S-Mj S-Mn L-Bb 
6njq X-ray 2.75 A 22-104  S-Bb S-Mn L-Bb L-Mj L-Mn 
1qn4 X-ray 1.86 A 22-104  S-Bb S-Mn L-Bb L-Mn 
1qn4 X-ray 1.86 B 22-104  S-Bb S-Mn L-Bb L-Mn 
1vol X-ray 2.7 B 22-104  S-Bb S-Mn L-Bb 
1qn3 X-ray 1.95 A 22-104  S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 
1qn3 X-ray 1.95 B 22-104  H-Bb S-Bb S-Mj S-Mn L-Bb L-Mj L-Mn 
1qn6 X-ray 2.1 B 22-104  S-Bb S-Mn L-Bb L-Mj L-Mn 
1qn6 X-ray 2.1 A 22-104  S-Bb S-Mn L-Bb L-Mj L-Mn 
1qnc X-ray 2.3 A 22-104  S-Bb S-Mn L-Bb 
1qnc X-ray 2.3 B 22-104  S-Bb S-Mn L-Bb L-Mj L-Mn 
1qne X-ray 1.9 A 22-104  S-Bb S-Mn L-Bb L-Mn 
1qne X-ray 1.9 B 22-104  S-Bb S-Mn L-Bb L-Mn 
1qn5 X-ray 1.93 B 22-104  S-Bb S-Mn L-Bb L-Mj L-Mn 
1qn5 X-ray 1.93 A 22-104  S-Bb S-Mn L-Bb L-Mj L-Mn 
1qn7 X-ray 2.3 A 22-104  S-Bb S-Mn L-Bb L-Mj L-Mn 
1qn7 X-ray 2.3 B 22-104  S-Bb S-Mn L-Bb L-Mj L-Mn 
6uer X-ray 2.5 A 22-104  S-Bb S-Mn L-Bb L-Mn 
6uer X-ray 2.5 B 22-104  S-Bb S-Mn L-Bb L-Mn 
1qna X-ray 1.8 A 22-104  S-Bb S-Mn L-Bb L-Mj L-Mn 
1qna X-ray 1.8 B 22-104  S-Bb S-Mn L-Bb L-Mj L-Mn 
6ueq X-ray 2.4 B 22-104  S-Bb S-Mn L-Bb L-Mn 
1qn9 X-ray 1.9 A 22-104  S-Bb S-Mj S-Mn L-Bb 
1qn9 X-ray 1.9 B 22-104  S-Bb S-Mn L-Bb L-Mj L-Mn 
1vtl X-ray 2.25 E 22-104  S-Bb S-Mn L-Bb L-Mn 
1vtl X-ray 2.25 F 22-104  S-Bb S-Mn L-Bb L-Mn 
1qn8 X-ray 2.1 A 22-104  S-Bb S-Mn L-Bb L-Mj L-Mn 
1qn8 X-ray 2.1 B 22-104  S-Bb S-Mn L-Bb L-Mj L-Mn 
6ueo X-ray 2 A 22-104  S-Bb S-Mn L-Bb L-Mj L-Mn 
6ueo X-ray 2 D 22-104  S-Bb S-Mn L-Bb L-Mj L-Mn 
6ueo X-ray 2 G 22-104  S-Bb S-Mj S-Mn L-Bb 
6ueo X-ray 2 J 22-104  S-Bb S-Mn L-Bb L-Mj L-Mn 
1vto X-ray 1.9 A 22-104  S-Bb S-Mn L-Bb L-Mn 
1vto X-ray 1.9 B 1022-1104  S-Bb S-Mn L-Bb L-Mn 
1qnb X-ray 2.23 A 22-104  S-Bb S-Mn L-Bb L-Mj L-Mn 
1qnb X-ray 2.23 B 22-104  S-Bb S-Mn L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text