Pfam domain
Pfam family: LAG1-DNAbind (PF09271.13)
Uniprot AC: P28159
RecName: Suppressor of hairless protein
Begin-End: 122-252
Organism: Drosophila melanogaster
Interaction Mode:  L-Bb L-Mj 

Sequence:
IVILHAKVAQKSYGNEKRFFCPPPCIYLFGSGWRRRYEEMLQQGEGEQGAQLCAFIGIGS
SDQDMQQLDLNGKQYCAAKTLFISDSDKRKHFMLSVKMFYGNGHDIGVFNSKRIKVISKP
SKKKQSLKNAD
Structures of the domain P28159 122-252
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5e24 X-ray 2.14 F 122-252 None
5e24 X-ray 2.14 E 122-252  L-Bb L-Mj 
5e24 X-ray 2.14 F 122-252 None
5e24 X-ray 2.14 E 122-252  L-Bb L-Mj 


© NPIDB team 2003 - 2021

text