Pfam domain
Pfam family: Ets (PF00178.21)
Uniprot AC: P28324
RecName: ETS domain-containing protein Elk-4
Begin-End: 6-85
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
TLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRY
YYVKNIIKKVNGQKFVYKFV
Structures of the domain P28324 6-85
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1bc8 X-ray 1.93 C 6-85 None
1bc7 X-ray 2.01 C 6-85  H-Bb H-Mj S-Bb L-Bb 
1hbx X-ray 3.15 G 7-85 None
1hbx X-ray 3.15 H 7-85 None
1k6o X-ray 3.19 A 306-385  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2019

text