Pfam domain
Pfam family: DNA_pol_B_exo1 (PF03104.21)
Uniprot AC: P28340
RecName: DNA polymerase delta catalytic subunit
Begin-End: 130-477
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VTDEGFSVCCHIHGFAPYFYTPAPPGFGPEHMGDLQRELNLAISRDSRGGRELTGPAVLA
VELCSRESMFGYHGHGPSPFLRITVALPRLVAPARRLLEQGIRVAGLGTPSFAPYEANVD
FEIRFMVDTDIVGCNWLELPAGKYALRLKEKATQCQLEADVLWSDVVSHPPEGPWQRIAP
LRVLSFDIECAGRKGIFPEPERDPVIQICSLGLRWGEPEPFLRLALTLRPCAPILGAKVQ
SYEKEEDLLQAWSTFIRIMDPDVITGYNIQNFDLPYLISRAQTLKVQTFPFLGRVAGLCS
NIRDSSFQSKQTGRRDTKVVSMVGRVQMDMLQVLLREYKLRSYTLNAV
Structures of the domain P28340 130-477
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6tnz X-ray 4.05 A 130-477 None
6s1m X-ray 4.27 A 130-477 None
6s1n X-ray 4.86 A 130-477  L-Mj 
6s1o X-ray 8.1 A 130-477  L-Bb L-Mj 
6tny X-ray 3.08 A 130-477 None


© NPIDB team 2003 - 2021

text