Pfam domain
Pfam family: DNA_pol_B (PF00136.23)
Uniprot AC: P28340
RecName: DNA polymerase delta catalytic subunit
Begin-End: 541-973
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VPLSYLLSRGQQVKVVSQLLRQAMHEGLLMPVVKSEGGEDYTGATVIEPLKGYYDVPIAT
LDFSSLYPSIMMAHNLCYTTLLRPGTAQKLGLTEDQFIRTPTGDEFVKTSVRKGLLPQIL
ENLLSARKRAKAELAKETDPLRRQVLDGRQLALKVSANSVYGFTGAQVGKLPCLEISQSV
TGFGRQMIEKTKQLVESKYTVENGYSTSAKVVYGDTDSVMCRFGVSSVAEAMALGREAAD
WVSGHFPSPIRLEFEKVYFPYLLISKKRYAGLLFSSRPDAHDRMDCKGLEAVRRDNCPLV
ANLVTASLRRLLIDRDPEGAVAHAQDVISDLLCNRIDISQLVITKELTRAASDYAGKQAH
VELAERMRKRDPGSAPSLGDRVPYVIISAAKGVAAYMKSEDPLFVLEHSLPIDTQYYLEQ
QLAKPLLRIFEPI
Structures of the domain P28340 541-973
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6tnz X-ray 4.05 A 541-973  H-Bb L-Bb L-Mn 
6s1m X-ray 4.27 A 541-973  H-Bb L-Bb L-Mn 
6s1n X-ray 4.86 A 541-973  H-Bb S-Bb L-Bb 
6s1o X-ray 8.1 A 541-973  H-Bb S-Bb L-Bb 
6tny X-ray 3.08 A 541-973  H-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text