Pfam domain
Pfam family: XPA_N (PF01286.20)
Uniprot AC: P28519
RecName: DNA repair protein RAD14
Begin-End: 189-219
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
PKCIECHINIEMDPVLHDVFKLQVCKQCSKE
Structures of the domain P28519 189-219
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5lcm X-ray 1.9 B 188-218 None
5lcm X-ray 1.9 A 188-218 None
5lcl X-ray 2.2 A 188-218 None
5a3d X-ray 1.8 B 188-218 None
5a3d X-ray 1.8 A 188-218 None
5g34 X-ray 1.9 B 188-218 None
5g34 X-ray 1.9 A 188-218 None
5g32 X-ray 2.2 A 188-218 None
5g32 X-ray 2.2 B 188-218 None
5a39 X-ray 2.8 A 100-130 None
5a39 X-ray 2.8 A 100-130 None
5g35 X-ray 2 B 188-218 None
5g35 X-ray 2 A 188-218 None
5g33 X-ray 2.4 B 188-218 None
5g33 X-ray 2.4 A 188-218 None


© NPIDB team 2003 - 2021

text