Pfam domain
Pfam family: XPA_C (PF05181.14)
Uniprot AC: P28519
RecName: DNA repair protein RAD14
Begin-End: 223-273
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 

Sequence:
KYALLTKTECKEDYFLTDPELNDEDLFHRLEKPNPHSGTFARMQLFVRCEV
Structures of the domain P28519 223-273
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5lcm X-ray 1.9 B 223-273  H-Bb S-Bb L-Bb L-Mj L-Mn 
5lcm X-ray 1.9 A 223-273  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
5lcl X-ray 2.2 A 223-273  H-Mj S-Bb L-Bb L-Mj L-Mn 
5lcl X-ray 2.2 B 223-273  H-Bb S-Bb L-Bb L-Mn 
5a3d X-ray 1.8 B 223-273  H-Bb S-Bb L-Bb L-Mj L-Mn 
5a3d X-ray 1.8 A 223-273  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
5g34 X-ray 1.9 B 223-273  H-Bb S-Bb L-Bb L-Mj L-Mn 
5g34 X-ray 1.9 A 223-273  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
5g32 X-ray 2.2 A 223-273  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
5g32 X-ray 2.2 B 223-273  H-Bb S-Bb L-Bb L-Mj L-Mn 
5a39 X-ray 2.8 A 135-185 None
5a39 X-ray 2.8 A 135-185 None
5g35 X-ray 2 B 223-273 None
5g35 X-ray 2 A 223-273 None
5g33 X-ray 2.4 A 223-273  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
5g33 X-ray 2.4 B 223-273  H-Bb S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text