Pfam domain
Pfam family: DNA_pol3_delt_C (PF14840.5)
Uniprot AC: P28630
RecName: DNA polymerase III subunit delta
Begin-End: 214-333
Organism: Escherichia coli
Interaction Mode:  L-Bb L-Mj L-Mn 

Sequence:
PFHWVDALLMGKSKRALHILQQLRLEGSEPVILLRTLQRELLLLVNLKRQSAHTPLRALF
DKHRVWQNRRGMMGEALNRLSQTQLRQAVQLLTRTELTLKQDYGQSVWAELEGLSLLLCH
Structures of the domain P28630 214-333
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3glg X-ray 3.25 F 214-333  L-Bb L-Mj L-Mn 
3glg X-ray 3.25 A 214-333 None
3gli X-ray 3.5 F 214-334  L-Bb L-Mj L-Mn 
3gli X-ray 3.5 A 214-333 None
3glf X-ray 3.39 A 214-333  L-Bb L-Mj L-Mn 
3glf X-ray 3.39 F 214-333 None


© NPIDB team 2003 - 2020

text