Pfam domain
Pfam family: Ribosomal_L20 (PF00453.17)
Uniprot AC: P28803
RecName: 50S ribosomal protein L20, chloroplastic
Begin-End: 3-111
Organism: Spinacia oleracea
Interaction Mode:   

Sequence:
RVKRGYIARRRRKKIRFFASSFRGAHSRLTRTIAQQKIRALVSAHRDRDRQKRDFRRLWI
TRINAAIRERGVYYNYSKFIHDLYKRQLLLNRKILAQIAILNPNCIYMI
Structures of the domain P28803 3-111
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x8t X-ray 3.3 R 3-107 None
5h1s X-ray 3.5 S 3-107 None
5mlc X-ray 3.9 S 3-107 None
5mmi X-ray 3.25 R 3-107 None


© NPIDB team 2003 - 2019

text