Pfam domain
Pfam family: BRF1 (PF07741.15)
Uniprot AC: P29056
RecName: Transcription factor IIIB 70 kDa subunit
Begin-End: 463-506
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
EDVDDEELNAHLLNEEASKLKERIWIGLNADFLLEQESKRLKQE
Structures of the domain P29056 463-506
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ngm X-ray 2.95 N 463-506 None
1ngm X-ray 2.95 F 463-506 None
1ngm X-ray 2.95 J 463-506 None
1ngm X-ray 2.95 B 463-506 None
6cnc X-ray 4.1 R 603-650 None
6cnf X-ray 4.5 R 603-650 None
6cnb X-ray 4.1 R 603-650 None
6f42 X-ray 5.5 V 463-505 None
6cnd X-ray 4.8 R 603-650 None


© NPIDB team 2003 - 2021

text