Pfam domain
Pfam family: TFIIB (PF00382.21)
Uniprot AC: P29056
RecName: Transcription factor IIIB 70 kDa subunit
Begin-End: 76-167
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
REATLNNARRKLRAVSYALHIPEYITDAAFQWYKLALANNFVQGRRSQNVIASCLYVACR
KEKTHHMLIDFSSRLQVSVYSIGATFLKMVKK
Structures of the domain P29056 76-167
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6eu0 X-ray 4 Z 76-167  H-Bb L-Bb 
6cnc X-ray 4.1 R 76-167  H-Bb H-Mj L-Bb 
6f44 X-ray 4.2 V 76-167  H-Bb L-Bb 
6f41 X-ray 4.3 V 76-167  H-Bb L-Bb 
6cnf X-ray 4.5 R 76-167  H-Bb H-Mj L-Bb 
6f40 X-ray 3.7 V 76-167  H-Bb L-Bb 
6cnb X-ray 4.1 R 76-167  H-Bb H-Mj L-Bb 
6f42 X-ray 5.5 V 76-167  H-Bb H-Mj L-Bb 
6cnd X-ray 4.8 R 76-167  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text