Pfam domain
Pfam family: S1 (PF00575.25)
Uniprot AC: P29344
RecName: 30S ribosomal protein S1, chloroplastic
Begin-End: 257-329
Organism: Spinacia oleracea
Interaction Mode:   

Sequence:
QLGIGSVVTGTVQSLKPYGAFIDIGGINGLLHVSQISHDRVSDIATVLQPGDTLKVMILS
HDRERGRVSLSTK
Structures of the domain P29344 257-329
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x8r X-ray 3.7 8 257-329 None


© NPIDB team 2003 - 2021

text