Pfam domain
Pfam family: Pur_DNA_glyco (PF02245.15)
Uniprot AC: P29372
RecName: DNA-3-methyladenine glycosylase
Begin-End: 89-283
Organism: Homo sapiens
Interaction Mode:   

Sequence:
EFFDQPAVPLARAFLGQVLVRRLPNGTELRGRIVETEAYLGPEDEAAHSRGGRQTPRNRG
MFMKPGTLYVYIIYGMYFCMNISSQGDGACVLLRALEPLEGLETMRQLRSTLRKGTASRV
LKDRELCSGPSKLCQALAINKSFDQRDLAQDEAVWLERGPLEPSEPAVVAAARVGVGHAG
EWARKPLRFYVRGSP
Structures of the domain P29372 89-283
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1f6o X-ray 2.4 A 89-283 None
1bnk X-ray 2.7 A 89-283 None
1f4r X-ray 2.4 A 89-283 None
1ewn X-ray 2.1 A 89-283 None
3qi5 X-ray 2.2 A 89-283 None
3qi5 X-ray 2.2 B 89-283 None
3uby X-ray 2 B 89-276 None


© NPIDB team 2003 - 2019

text